PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK20247.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family Whirly
Protein Properties Length: 239aa    MW: 26275.3 Da    PI: 10.2781
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK20247.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly182.11e-56601952137
     Whirly   2 vyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePlpd 101
                vyk+kaa++v +v+ptf++ldsg  +++r G ++l++++a++erkydWek+q fals+tev++l++l+++++ce+fhdp++ +sn+G+vrk+l v+P++ 
  PK20247.1  60 VYKGKAAFSVTPVLPTFTKLDSGLHVVDRGGCMMLKFTPAIGERKYDWEKRQLFALSPTEVGSLISLGPNDTCELFHDPSMLSSNAGQVRKSLTVKPHST 159
                8*************************************************************************************************** PP

     Whirly 102 GsGlfvnlsvtnslvkgnesfsvPvskaefavlrsl 137
                G G++++l+v n+++k+++++svP + aefav++ +
  PK20247.1 160 GGGYMISLTVVNNILKTKDYISVPFTTAEFAVVKAA 195
                *********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.105.5E-6756217IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544471.57E-5956217IPR009044ssDNA-binding transcriptional regulator
PfamPF085362.0E-5460194IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005739Cellular Componentmitochondrion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MKKLSRLLLT SRNQISRNIT NGKDGNLSNG LLLRTFTSHA GISTSGQNIN VKGFSAPYIV  60
YKGKAAFSVT PVLPTFTKLD SGLHVVDRGG CMMLKFTPAI GERKYDWEKR QLFALSPTEV  120
GSLISLGPND TCELFHDPSM LSSNAGQVRK SLTVKPHSTG GGYMISLTVV NNILKTKDYI  180
SVPFTTAEFA VVKAACSYAL PHIMGWDRVT EKVEKVNGGR RTPDIKFDRG QLMNSEWDK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4kop_A1e-785621413171Single-stranded DNA-binding protein WHY2, mit
4kop_B1e-785621413171Single-stranded DNA-binding protein WHY2, mit
4kop_C1e-785621413171Single-stranded DNA-binding protein WHY2, mit
4kop_D1e-785621413171Single-stranded DNA-binding protein WHY2, mit
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010112062.11e-105Protein BEARSKIN1
SwissprotQ8VYF71e-80WHY2_ARATH; Single-stranded DNA-binding protein WHY2, mitochondrial
TrEMBLW9SHN51e-105W9SHN5_9R
STRINGGLYMA19G43880.24e-84(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF113833338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71260.18e-82WHIRLY 2